PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10018016m
Common NameCICLE_v10018016mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family SAP
Protein Properties Length: 472aa    MW: 52488.6 Da    PI: 6.6236
Description SAP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10018016mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SAP701.78.2e-21414711454
              SAP   1 mssssssssses.eegseggeggdass............gesegpsssrqr..aanevwpePflealatqvaidasrslGrlaaasalanvfqv 79 
                      msssssssss+s +++se g+g +++s            g++egpsssrqr  a+nevwpePf+eala+qvai+asrs+Grlaaa alanvfqv
  Ciclev10018016m   1 MSSSSSSSSSSSsSSSSEDGNGNGNGSggvgghygarrgGDFEGPSSSRQRrrAVNEVWPEPFVEALAAQVAIEASRSVGRLAAAAALANVFQV 94 
                      55555544444303344444444444467889*******9***99988765559**************************************** PP

              SAP  80 cstwravsrsdllwqrltrriWrrtkllrdtWreeyiyrhrtarnfrtrrysyvtlqfdpadvdedndadalsCrclalsdkylaaGfadGavr 173
                      cstwravsrsdllw+rltrriW rt+ll++tWr+eyiyrhrta+nfrtrry++++l fdp+dvd+   +d l+Crcl+lsd yla+GfadGavr
  Ciclev10018016m  95 CSTWRAVSRSDLLWHRLTRRIWGRTNLLHATWRDEYIYRHRTAQNFRTRRYTHFNLYFDPSDVDN---PDGLTCRCLTLSDLYLACGFADGAVR 185
                      *************************************************************9988...689*********************** PP

              SAP 174 lfdletrlhvstflpqhrdrlGrfsravsGivisdsrlvfatldGdihvavidgagaaaarrallGdvvndGalvdfaGsgrWwvGlyaGvpGr 267
                      lfdl+trlh++tf+pqh drlG+fsravsGi+++ s+l+fatldGdihvavid ++  ++r+a++G v++dG+l+df+G++r+wvGlyaG +Gr
  Ciclev10018016m 186 LFDLTTRLHIRTFRPQHSDRLGQFSRAVSGIILTASQLIFATLDGDIHVAVIDDVA-NETRTAHFGSVMDDGVLIDFTGCSRYWVGLYAGLAGR 278
                      *****************************************************965.89*********************************** PP

              SAP 268 afhiWdaeteelvfvGGsltdPeavmGWhmlteltelvGrvrvteretavaCtslrlvvfdlrnqgvvlreeeerrGlivssldasneayvvvd 361
                      afhiWd ++ee vfvGG ltd ++vmGW mlte+te+vGrvrvt++e+avaCts+r+++fdlrnqg+vl+e+   rG+ v+s+d+++eay+vv+
  Ciclev10018016m 279 AFHIWDRQAEE-VFVGGDLTDHNTVMGWRMLTEFTEFVGRVRVTSHESAVACTSSRVITFDLRNQGMVLGERGYGRGIYVTSVDVNAEAYIVVE 371
                      ******99987.9********************************************************************************9 PP

              SAP 362 srG.......vatvrrvenleevcrfrvrg.aqrgvlgCvnggyalvyaggvlrvWeiekkegylyslrervg.evnalvaddrhvavsssdgt 446
                      +r         a+vrrv+++eevcrf++r+  + +v+gC+n+gyal++  gv+rvWe+e  e y+ys+rer+g ev a+v ddrhva+s   ++
  Ciclev10018016m 372 NRElenqnrrLAIVRRVDTFEEVCRFSLRAdRNVNVMGCMNQGYALMCVEGVIRVWEVEGGE-YMYSFRERIGeEVIAFVGDDRHVAASC-GTN 463
                      7642222222799****************988899************************966.**********899**********9876.689 PP

              SAP 447 ihlldfga 454
                      ihl+dfga
  Ciclev10018016m 464 IHLWDFGA 471
                      ******97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.1280.503.8E-886150No hitNo description
SuperFamilySSF813832.62E-887136IPR001810F-box domain
SuperFamilySSF509783.66E-11160469IPR017986WD40-repeat-containing domain
Gene3DG3DSA:2.130.10.101.3E-9162244IPR015943WD40/YVTN repeat-like-containing domain
Gene3DG3DSA:2.130.10.101.3E-9299469IPR015943WD40/YVTN repeat-like-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009554Biological Processmegasporogenesis
GO:0009908Biological Processflower development
GO:0030163Biological Processprotein catabolic process
GO:0046622Biological Processpositive regulation of organ growth
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 472 aa     Download sequence    Send to blast
MSSSSSSSSS SSSSSSSEDG NGNGNGSGGV GGHYGARRGG DFEGPSSSRQ RRRAVNEVWP  60
EPFVEALAAQ VAIEASRSVG RLAAAAALAN VFQVCSTWRA VSRSDLLWHR LTRRIWGRTN  120
LLHATWRDEY IYRHRTAQNF RTRRYTHFNL YFDPSDVDNP DGLTCRCLTL SDLYLACGFA  180
DGAVRLFDLT TRLHIRTFRP QHSDRLGQFS RAVSGIILTA SQLIFATLDG DIHVAVIDDV  240
ANETRTAHFG SVMDDGVLID FTGCSRYWVG LYAGLAGRAF HIWDRQAEEV FVGGDLTDHN  300
TVMGWRMLTE FTEFVGRVRV TSHESAVACT SSRVITFDLR NQGMVLGERG YGRGIYVTSV  360
DVNAEAYIVV ENRELENQNR RLAIVRRVDT FEEVCRFSLR ADRNVNVMGC MNQGYALMCV  420
EGVIRVWEVE GGEYMYSFRE RIGEEVIAFV GDDRHVAASC GTNIHLWDFG A*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006447777.10.0hypothetical protein CICLE_v10018016mg
SwissprotQ9FKH11e-179SAP_ARATH; Transcriptional regulator STERILE APETALA
TrEMBLV4U4Z10.0V4U4Z1_9R
STRINGAT5G35770.11e-177(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM110182634
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35770.11e-179SAP family protein